Lineage for d2yjab_ (2yja B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2341442Protein Estrogen receptor alpha [48519] (1 species)
  7. 2341443Species Human (Homo sapiens) [TaxId:9606] [48520] (82 PDB entries)
    Uniprot P03372 307-551
  8. 2341453Domain d2yjab_: 2yja B: [191839]
    automated match to d1qkua_
    complexed with est

Details for d2yjab_

PDB Entry: 2yja (more details), 1.82 Å

PDB Description: stapled peptides binding to estrogen receptor alpha.
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d2yjab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjab_ a.123.1.1 (B:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
dahrl

SCOPe Domain Coordinates for d2yjab_:

Click to download the PDB-style file with coordinates for d2yjab_.
(The format of our PDB-style files is described here.)

Timeline for d2yjab_: