Lineage for d2yfeb_ (2yfe B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009481Domain d2yfeb_: 2yfe B: [191838]
    automated match to d3ty0a_
    complexed with yfe

Details for d2yfeb_

PDB Entry: 2yfe (more details), 2 Å

PDB Description: Ligand binding domain of human PPAR gamma in complex with amorfrutin 1
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2yfeb_:

Sequence, based on SEQRES records: (download)

>d2yfeb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
vtehvqllqvikktetdmslhpllqeiyk

Sequence, based on observed residues (ATOM records): (download)

>d2yfeb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
hitpskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytm
laslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifia
viilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivteh
vqllqvikktetdmlhpllqeiyk

SCOPe Domain Coordinates for d2yfeb_:

Click to download the PDB-style file with coordinates for d2yfeb_.
(The format of our PDB-style files is described here.)

Timeline for d2yfeb_: