Lineage for d2yfea_ (2yfe A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009480Domain d2yfea_: 2yfe A: [191837]
    automated match to d3ty0a_
    complexed with yfe

Details for d2yfea_

PDB Entry: 2yfe (more details), 2 Å

PDB Description: Ligand binding domain of human PPAR gamma in complex with amorfrutin 1
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2yfea_:

Sequence, based on SEQRES records: (download)

>d2yfea_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
lrqivtehvqllqvikktetdmslhpllqeiykdl

Sequence, based on observed residues (ATOM records): (download)

>d2yfea_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
iskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlas
lmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiavii
lsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvql
lqvikktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d2yfea_:

Click to download the PDB-style file with coordinates for d2yfea_.
(The format of our PDB-style files is described here.)

Timeline for d2yfea_: