SCOPe 2.05: Domain d2whza_: 2whz A:

Lineage for d2whza_ (2whz A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
   includes alpha-helical C-terminal domain characteristic for the family

6. Protein Thermolysin [63414] (3 species)

7. Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (124 PDB entries)
   Uniprot P00800

8. Domain d2whza_: 2whz A: [191834]
   automated match to d1kkka_
   complexed with ca, ile, peg, tyr, zn

Details for d2whza_

PDB Entry: 2whz, 1.75 Å

PDB Description: dipeptide inhibitors of thermolysin

PDB Compounds: (A:) thermolysin

SCOPe Domain Sequences for d2whza_:

Sequence; same for both SEQRES and ATOM records:

>d2whza_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

Timeline for d2whza_:

• d2whza_ first appeared in SCOPe 2.02
  
• d2whza_ appears in SCOPe 2.04
  
• d2whza_ appears in SCOPe 2.06
  
• d2whza_ appears in the current release, SCOPe 2.08