Lineage for d2lkxa1 (2lkx A:1-60)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691940Protein Pituitary homeobox 2 [140151] (1 species)
  7. 2691941Species Human (Homo sapiens) [TaxId:9606] [140152] (1 PDB entry)
    Uniprot Q99697 85-144
  8. 2691942Domain d2lkxa1: 2lkx A:1-60 [191830]
    Other proteins in same PDB: d2lkxa2, d2lkxa3
    protein/DNA complex

Details for d2lkxa1

PDB Entry: 2lkx (more details)

PDB Description: nmr structure of the homeodomain of pitx2 in complex with a taatcc dna binding site
PDB Compounds: (A:) Pituitary homeobox 3

SCOPe Domain Sequences for d2lkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lkxa1 a.4.1.1 (A:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]}
qrrqrthftsqqlqeleatfqrnrypdmstreeiavwtnltearvrvwfknrrakwrkre

SCOPe Domain Coordinates for d2lkxa1:

Click to download the PDB-style file with coordinates for d2lkxa1.
(The format of our PDB-style files is described here.)

Timeline for d2lkxa1: