![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Pituitary homeobox 2 [140151] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140152] (1 PDB entry) Uniprot Q99697 85-144 |
![]() | Domain d2lkxa1: 2lkx A:1-60 [191830] Other proteins in same PDB: d2lkxa2, d2lkxa3 protein/DNA complex |
PDB Entry: 2lkx (more details)
SCOPe Domain Sequences for d2lkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lkxa1 a.4.1.1 (A:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} qrrqrthftsqqlqeleatfqrnrypdmstreeiavwtnltearvrvwfknrrakwrkre
Timeline for d2lkxa1: