SCOPe 2.07: Domain d2egdb_: 2egd B:

Lineage for d2egdb_ (2egd B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100a13 [TaxId:9606] [140535] (2 PDB entries)
   Uniprot Q99584 1-98

8. Domain d2egdb_: 2egd B: [191828]
   automated match to d1yuta1
   complexed with ca

Details for d2egdb_

PDB Entry: 2egd, 1.8 Å

PDB Description: Crystal structure of human S100A13 in the Ca2+-bound state

PDB Compounds: (B:) Protein S100-A13

SCOPe Domain Sequences for d2egdb_:

Sequence; same for both SEQRES and ATOM records:

>d2egdb_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]}
lteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekmksldv
nqdselkfneywrligelakeirkkkdlkir

Timeline for d2egdb_:

• d2egdb_ first appeared in SCOPe 2.02
  
• d2egdb_ appears in SCOPe 2.06
  
• d2egdb_ appears in the current release, SCOPe 2.08