SCOPe 2.03: Domain d3sfpc_: 3sfp C:

Lineage for d3sfpc_ (3sfp C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (8 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (16 PDB entries)

8. Domain d3sfpc_: 3sfp C: [191817]
   automated match to d3srxa_
   complexed with cit, cl, gol, so4, zn

Details for d3sfpc_

PDB Entry: 3sfp, 2.27 Å

PDB Description: Crystal Structure of the Mono-Zinc-boundform of New Delhi Metallo-beta-Lactamase-1 from Klebsiella pneumoniae

PDB Compounds: (C:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d3sfpc_:

Sequence; same for both SEQRES and ATOM records:

>d3sfpc_ d.157.1.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
etgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqta
qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqh
sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

Timeline for d3sfpc_:

• d3sfpc_ first appeared in SCOPe 2.02
  
• d3sfpc_ appears in SCOPe 2.04
  
• d3sfpc_ appears in the current release, SCOPe 2.08