SCOPe 2.07: Domain d3qjsc_: 3qjs C:

Lineage for d3qjsc_ (3qjs C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family)
   automatically mapped to Pfam PF08113

5. Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
   functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II

7. Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries)

8. Domain d3qjsc_: 3qjs C: [191812]
   Other proteins in same PDB: d3qjsa_, d3qjsb1, d3qjsb2
   automated match to d1xmec1
   complexed with cmo, cu1, cua, has, hem

Details for d3qjsc_

PDB Entry: 3qjs, 2.8 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus

PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d3qjsc_:

Sequence; same for both SEQRES and ATOM records:

>d3qjsc_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

Timeline for d3qjsc_:

• d3qjsc_ first appeared in SCOPe 2.02
  
• d3qjsc_ appears in SCOPe 2.06
  
• d3qjsc_ appears in the current release, SCOPe 2.08