Lineage for d3pxxf1 (3pxx F:1-283)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095385Species Mycobacterium avium [TaxId:243243] [189589] (5 PDB entries)
  8. 2095401Domain d3pxxf1: 3pxx F:1-283 [191809]
    Other proteins in same PDB: d3pxxa2, d3pxxc2, d3pxxf2
    automated match to d3pxxa_
    complexed with nad

Details for d3pxxf1

PDB Entry: 3pxx (more details), 2 Å

PDB Description: crystal structure of carveol dehydrogenase from mycobacterium avium bound to nicotinamide adenine dinucleotide
PDB Compounds: (F:) carveol dehydrogenase

SCOPe Domain Sequences for d3pxxf1:

Sequence, based on SEQRES records: (download)

>d3pxxf1 c.2.1.0 (F:1-283) automated matches {Mycobacterium avium [TaxId: 243243]}
mgrvqdkvvlvtggargqgrshavklaeegadiilfdichdietneyplatsrdleeagl
evektgrkaytaevdvrdraavsrelanavaefgkldvvvanagicplgahlpvqafada
fdvdfvgvintvhaalpyltsgasiittgsvagliaaaqppgaggpqgpggagysyakql
vdsytlqlaaqlapqsiranvihptnvntdmlnsapmyrqfrpdleapsradallafpam
qamptpyveasdisnavcflasdesryvtglqfkvdagamlkf

Sequence, based on observed residues (ATOM records): (download)

>d3pxxf1 c.2.1.0 (F:1-283) automated matches {Mycobacterium avium [TaxId: 243243]}
mgrvqdkvvlvtggargqgrshavklaeegadiilfdichdietneyplatsrdleeagl
evektgrkaytaevdvrdraavsrelanavaefgkldvvvanagicplgahlpvqafada
fdvdfvgvintvhaalpyltsgasiittgsvagliaagpggagysyakqlvdsytlqlaa
qlapqsiranvihptnvntdmlnsapmyrqfrpdleapsradallafpamqamptpyvea
sdisnavcflasdesryvtglqfkvdagamlkf

SCOPe Domain Coordinates for d3pxxf1:

Click to download the PDB-style file with coordinates for d3pxxf1.
(The format of our PDB-style files is described here.)

Timeline for d3pxxf1: