![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (5 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
![]() | Protein Fumarate reductase subunit FrdD [81372] (2 species) |
![]() | Species Escherichia coli [TaxId:536056] [192449] (1 PDB entry) |
![]() | Domain d3p4pd_: 3p4p D: [191807] Other proteins in same PDB: d3p4pc_, d3p4po_ automated match to d1kf6d_ complexed with f3s, fad, fes, fum, sf4 |
PDB Entry: 3p4p (more details), 2.8 Å
SCOPe Domain Sequences for d3p4pd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p4pd_ f.21.2.2 (D:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 536056]} minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti
Timeline for d3p4pd_: