Lineage for d3osub_ (3osu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848565Species Staphylococcus aureus [TaxId:158878] [189493] (1 PDB entry)
  8. 2848567Domain d3osub_: 3osu B: [191803]
    automated match to d3osua_
    complexed with mg, peg, po4

Details for d3osub_

PDB Entry: 3osu (more details), 1.9 Å

PDB Description: crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] reductase

SCOPe Domain Sequences for d3osub_:

Sequence, based on SEQRES records: (download)

>d3osub_ c.2.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
ksalvtgasrgigrsialqlaeegynvavnyagskekaeavveeikakgvdsfaiqanva
dadevkamikevvsqfgsldvlvnnagitrdnllmrmkeqewddvidtnlkgvfnciqka
tpqmlrqrsgaiinlssvvgavgnpgqanyvatkagvigltksaarelasrgitvnavap
gfivsdmtdalsdelkeqmltqiplarfgqdtdiantvaflasdkakyitgqtihvnggm
ym

Sequence, based on observed residues (ATOM records): (download)

>d3osub_ c.2.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]}
ksalvtgasrgigrsialqlaeegynvavnyagskekaeavveeikakgvdsfaiqanva
dadevkamikevvsqfgsldvlvnnagitrdnllmrmkeqewddvidtnlkgvfnciqka
tpqmlrqrsgaiinlssvvgavgnpgqanyvatkagvigltksaarelasrgitvnavap
gfivsdmlsdelkeqmltqiplarfgqdtdiantvaflasdkakyitgqtihvnggmym

SCOPe Domain Coordinates for d3osub_:

Click to download the PDB-style file with coordinates for d3osub_.
(The format of our PDB-style files is described here.)

Timeline for d3osub_: