Lineage for d1bc9a_ (1bc9 A:)
- Root: SCOPe 2.01
Class a: All alpha proteins [46456] (284 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.3: Sec7 domain [48425] (2 families) 
Family a.118.3.1: Sec7 domain [48426] (5 proteins)
Pfam PF01369
Protein Cytohesin-1/b2-1 [48429] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [48430] (1 PDB entry) 
Domain d1bc9a_: 1bc9 A: [19180]
Details for d1bc9a_
PDB Entry: 1bc9 (more details)
PDB Description: cytohesin-1/b2-1 sec7 domain, nmr, minimized average structure
PDB Compounds: (A:) cytohesin-1SCOPe Domain Sequences for d1bc9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bc9a_ a.118.3.1 (A:) Cytohesin-1/b2-1 {Human (Homo sapiens) [TaxId: 9606]}
mknmqrnkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdyl
gerdefniqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcn
ngvfqstdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnly
esiknepfkipelehhhhhh
SCOPe Domain Coordinates for d1bc9a_:
Click to download the PDB-style file with coordinates for d1bc9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bc9a_:
- d1bc9a_ first appeared (with stable ids) in SCOP 1.55, called d1bc9__
- d1bc9a_ appears in SCOP 1.75
- d1bc9a_ appears in SCOPe 2.02
- d1bc9a_ appears in the current release, SCOPe 2.08
View in 3D