Lineage for d1bc9__ (1bc9 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.3: Sec7 domain [48425] (1 family) 
Family a.118.3.1: Sec7 domain [48426] (2 proteins) 
Protein Cytohesin-1/b2-1 [48429] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48430] (1 PDB entry) 
Domain d1bc9__: 1bc9 - [19180]
Details for d1bc9__
PDB Entry: 1bc9 (more details)
PDB Description: cytohesin-1/b2-1 sec7 domain, nmr, minimized average structure
SCOP Domain Sequences for d1bc9__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bc9__ a.118.3.1 (-) Cytohesin-1/b2-1 {Human (Homo sapiens)}
mknmqrnkqvamgrkkfnmdpkkgiqfliendllkntcediaqflykgeglnktaigdyl
gerdefniqvlhafvelheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycqcn
ngvfqstdtcyvlsfaiimlntslhnpnvkdkptverfiamnrgindggdlpeellrnly
esiknepfkipelehhhhhh
SCOP Domain Coordinates for d1bc9__:
Click to download the PDB-style file with coordinates for d1bc9__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bc9__:
- d1bc9__ appears in SCOP 1.57
- d1bc9__ appears in the current release, SCOPe 2.08, called d1bc9a_
View in 3D