SCOPe 2.03: Domain d3mvdf_: 3mvd F:

Lineage for d3mvdf_ (3mvd F:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (7 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (38 PDB entries)

8. Domain d3mvdf_: 3mvd F: [191791]
   Other proteins in same PDB: d3mvda_, d3mvdc_, d3mvdd_, d3mvde_, d3mvdg_, d3mvdh_
   automated match to d1kx5b_
   protein/DNA complex

Details for d3mvdf_

PDB Entry: 3mvd, 2.9 Å

PDB Description: Crystal structure of the chromatin factor RCC1 in complex with the nucleosome core particle

PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d3mvdf_:

Sequence; same for both SEQRES and ATOM records:

>d3mvdf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
krktvtamdvvyalkrqgrtlygfgg

Timeline for d3mvdf_:

• d3mvdf_ first appeared in SCOPe 2.02
  
• d3mvdf_ appears in SCOPe 2.04
  
• d3mvdf_ appears in the current release, SCOPe 2.08