Lineage for d3mvdf_ (3mvd F:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082927Protein Histone H4 [47125] (7 species)
  7. 1082928Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 1082956Domain d3mvdf_: 3mvd F: [191791]
    Other proteins in same PDB: d3mvda_, d3mvdd_, d3mvde_, d3mvdh_
    automated match to d1kx5b_
    protein/DNA complex

Details for d3mvdf_

PDB Entry: 3mvd (more details), 2.9 Å

PDB Description: Crystal structure of the chromatin factor RCC1 in complex with the nucleosome core particle
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d3mvdf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mvdf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
krktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d3mvdf_:

Click to download the PDB-style file with coordinates for d3mvdf_.
(The format of our PDB-style files is described here.)

Timeline for d3mvdf_: