Lineage for d1pbva_ (1pbv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010331Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2010332Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 2010348Protein Exchange factor ARNO [48427] (1 species)
  7. 2010349Species Human (Homo sapiens) [TaxId:9606] [48428] (6 PDB entries)
  8. 2010354Domain d1pbva_: 1pbv A: [19179]

Details for d1pbva_

PDB Entry: 1pbv (more details), 2 Å

PDB Description: sec7 domain of the exchange factor arno
PDB Compounds: (A:) arno

SCOPe Domain Sequences for d1pbva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbva_ a.118.3.1 (A:) Exchange factor ARNO {Human (Homo sapiens) [TaxId: 9606]}
anegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktai
gdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqry
clcnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeell
rnlydsirnepfkip

SCOPe Domain Coordinates for d1pbva_:

Click to download the PDB-style file with coordinates for d1pbva_.
(The format of our PDB-style files is described here.)

Timeline for d1pbva_: