Lineage for d1pbv__ (1pbv -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies) 
Superfamily a.118.3: Sec7 domain [48425] (1 family) 
Family a.118.3.1: Sec7 domain [48426] (2 proteins) Protein Exchange factor ARNO [48427] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48428] (1 PDB entry) 
Domain d1pbv__: 1pbv - [19179]
Details for d1pbv__
PDB Entry: 1pbv (more details), 2 Å
PDB Description: sec7 domain of the exchange factor arno
SCOP Domain Sequences for d1pbv__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pbv__ a.118.3.1 (-) Exchange factor ARNO {Human (Homo sapiens)}
anegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktai
gdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqry
clcnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeell
rnlydsirnepfkip
SCOP Domain Coordinates for d1pbv__:
Click to download the PDB-style file with coordinates for d1pbv__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pbv__:
- d1pbv__ appears in SCOP 1.57
- d1pbv__ appears in the current release, SCOPe 2.08, called d1pbva_
View in 3D