Lineage for d1pbv__ (1pbv -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6168Superfamily a.118.3: Sec7 domain [48425] (1 family) (S)
  5. 6169Family a.118.3.1: Sec7 domain [48426] (2 proteins)
  6. 6173Protein Exchange factor ARNO [48427] (1 species)
  7. 6174Species Human (Homo sapiens) [TaxId:9606] [48428] (1 PDB entry)
  8. 6175Domain d1pbv__: 1pbv - [19179]

Details for d1pbv__

PDB Entry: 1pbv (more details), 2 Å

PDB Description: sec7 domain of the exchange factor arno

SCOP Domain Sequences for d1pbv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbv__ a.118.3.1 (-) Exchange factor ARNO {Human (Homo sapiens)}
anegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktai
gdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqry
clcnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeell
rnlydsirnepfkip

SCOP Domain Coordinates for d1pbv__:

Click to download the PDB-style file with coordinates for d1pbv__.
(The format of our PDB-style files is described here.)

Timeline for d1pbv__: