Lineage for d1pbva_ (1pbv A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.3: Sec7 domain [48425] (2 families) 
Family a.118.3.1: Sec7 domain [48426] (6 proteins)
Pfam PF01369
Protein Exchange factor ARNO [48427] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48428] (6 PDB entries) 
Domain d1pbva_: 1pbv A: [19179]
Details for d1pbva_
PDB Entry: 1pbv (more details), 2 Å
PDB Description: sec7 domain of the exchange factor arno
PDB Compounds: (A:) arnoSCOPe Domain Sequences for d1pbva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pbva_ a.118.3.1 (A:) Exchange factor ARNO {Human (Homo sapiens) [TaxId: 9606]}
anegsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktai
gdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqry
clcnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeell
rnlydsirnepfkip
SCOPe Domain Coordinates for d1pbva_:
Click to download the PDB-style file with coordinates for d1pbva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pbva_:
- d1pbva_ first appeared (with stable ids) in SCOP 1.55, called d1pbv__
- d1pbva_ appears in SCOPe 2.07
View in 3D