Lineage for d3mnnd_ (3mnn D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725769Protein Histone H2B [47119] (6 species)
  7. 1725770Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (35 PDB entries)
  8. 1725793Domain d3mnnd_: 3mnn D: [191786]
    Other proteins in same PDB: d3mnna_, d3mnnb_, d3mnnc_, d3mnne_, d3mnnf_, d3mnng_
    automated match to d1kx5d_
    protein/DNA complex; complexed with mg, mml, ptw, ru, so4

Details for d3mnnd_

PDB Entry: 3mnn (more details), 2.5 Å

PDB Description: a ruthenium antitumour agent forms specific histone protein adducts in the nucleosome core
PDB Compounds: (D:) Histone H2B 1.1

SCOPe Domain Sequences for d3mnnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mnnd_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d3mnnd_:

Click to download the PDB-style file with coordinates for d3mnnd_.
(The format of our PDB-style files is described here.)

Timeline for d3mnnd_: