SCOPe 2.07: Domain d1dcqa1: 1dcq A:369-522

Lineage for d1dcqa1 (1dcq A:369-522)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Pyk2-associated protein beta [48423] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48424] (1 PDB entry)

8. Domain d1dcqa1: 1dcq A:369-522 [19178]
   Other proteins in same PDB: d1dcqa2
   complexed with zn

Details for d1dcqa1

PDB Entry: 1dcq, 2.1 Å

PDB Description: crystal structure of the arf-gap domain and ankyrin repeats of papbeta.

PDB Compounds: (A:) pyk2-associated protein beta

SCOPe Domain Sequences for d1dcqa1:

Sequence; same for both SEQRES and ATOM records:

>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]}
adtaaklhslceavktrdifgllqayadgvdltekiplanghepdetalhlavrsvdrts
lhivdflvqnsgnldkqtgkgstalhyccltdnaeclklllrgkasieianesgetpldi
akrlkhehceelltqalsgrfnshvhveyewrll

Timeline for d1dcqa1:

• d1dcqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1dcqa1 appears in SCOPe 2.06
  
• d1dcqa1 appears in the current release, SCOPe 2.08