| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries) |
| Domain d3mgqb_: 3mgq B: [191777] Other proteins in same PDB: d3mgqa_, d3mgqc_, d3mgqd_, d3mgqe_, d3mgqg_, d3mgqh_ automated match to d1kx5b_ protein/DNA complex; complexed with cl, ni |
PDB Entry: 3mgq (more details), 2.65 Å
SCOPe Domain Sequences for d3mgqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mgqb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg
Timeline for d3mgqb_: