Lineage for d3lelc_ (3lel C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698058Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries)
  8. 2698113Domain d3lelc_: 3lel C: [191755]
    Other proteins in same PDB: d3lela_, d3lelb_, d3leld_, d3lele_, d3lelf_, d3lelh_, d3lelk_, d3lell_, d3leln_, d3lelo_, d3lelp_, d3lelr_
    automated match to d1kx5c_
    protein/DNA complex; complexed with mn

Details for d3lelc_

PDB Entry: 3lel (more details), 2.95 Å

PDB Description: Structural Insight into the Sequence-Dependence of Nucleosome Positioning
PDB Compounds: (C:) histone h2a

SCOPe Domain Sequences for d3lelc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lelc_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardnk
ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOPe Domain Coordinates for d3lelc_:

Click to download the PDB-style file with coordinates for d3lelc_.
(The format of our PDB-style files is described here.)

Timeline for d3lelc_: