SCOPe 2.08: Domain d3kwnb1: 3kwn B:1-217

Lineage for d3kwnb1 (3kwn B:1-217)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries)

8. Domain d3kwnb1: 3kwn B:1-217 [191753]
   Other proteins in same PDB: d3kwna2, d3kwnb2
   automated match to d3kwna_
   complexed with 23z

Details for d3kwnb1

PDB Entry: 3kwn, 2.1 Å

PDB Description: cathepsin s in complex with thioether acetamide p3 inhibitor

PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d3kwnb1:

Sequence; same for both SEQRES and ATOM records:

>d3kwnb1 d.3.1.1 (B:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d3kwnb1:

• d3kwnb1 first appeared in SCOPe 2.02, called d3kwnb_
  
• d3kwnb1 appears in SCOPe 2.07