| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.1: Papain-like [54002] (26 proteins) |
| Protein (Pro)cathepsin S [82566] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82567] (28 PDB entries) |
| Domain d3kwnb1: 3kwn B:1-217 [191753] Other proteins in same PDB: d3kwna2, d3kwnb2 automated match to d3kwna_ complexed with 23z |
PDB Entry: 3kwn (more details), 2.1 Å
SCOPe Domain Sequences for d3kwnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kwnb1 d.3.1.1 (B:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
lpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei
Timeline for d3kwnb1: