SCOPe 2.08: Domain d3ixob_: 3ixo B:

Lineage for d3ixob_ (3ixo B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries)

8. Domain d3ixob_: 3ixo B: [191743]
   automated match to d3ixoa_
   protein/DNA complex; protein/RNA complex

Details for d3ixob_

PDB Entry: 3ixo, 1.7 Å

PDB Description: Crystal Structure of uncomplexed HIV_1 Protease Subtype A

PDB Compounds: (B:) hiv-1 protease

SCOPe Domain Sequences for d3ixob_:

Sequence; same for both SEQRES and ATOM records:

>d3ixob_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrplvtvkiggqlrealldtgaddtvleeinlpgkwkpkmiggiggfikvkqyd
qilieicgkkaigtvlvgptsvniigrnmltqigctlnf

Timeline for d3ixob_:

• d3ixob_ first appeared in SCOPe 2.02
  
• d3ixob_ appears in SCOPe 2.07