SCOPe 2.04: Domain d3hy9b_: 3hy9 B:

Lineage for d3hy9b_ (3hy9 B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (26 PDB entries)

8. Domain d3hy9b_: 3hy9 B: [191740]
   automated match to d3b8za_
   complexed with 098, ca, zn

Details for d3hy9b_

PDB Entry: 3hy9, 2.02 Å

PDB Description: crystal structure of the catalytic domain of adamts-5 in complex with an amino-2-indanol compound

PDB Compounds: (B:) Catalytic Domain of ADAMTS-5

SCOPe Domain Sequences for d3hy9b_:

Sequence; same for both SEQRES and ATOM records:

>d3hy9b_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asisrarqvelllvadasmarkygrglqhylltlasianrlyshasienhirlavvkvvv
lgdkdkslevsknaattlknfckwqhqhnqlgddheehydaailftredlcghhscdtlg
madvgticsperscavieddglhaaftvaheighllglshddskfceetfgstedkrlms
siltsidaskpwskctsatiteflddghgnclldlprkqi

Timeline for d3hy9b_:

• d3hy9b_ first appeared in SCOPe 2.02
  
• d3hy9b_ appears in SCOPe 2.03
  
• d3hy9b_ appears in SCOPe 2.05
  
• d3hy9b_ appears in the current release, SCOPe 2.08, called d3hy9b1