![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187190] (2 PDB entries) |
![]() | Domain d3hrwc_: 3hrw C: [191739] automated match to d3hrwa_ complexed with hem |
PDB Entry: 3hrw (more details), 2.8 Å
SCOPe Domain Sequences for d3hrwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hrwc_ a.1.1.2 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vlsgedksnikaawgkigghgaeygaealermfasfpttktyfphfdvshgsaqvkghgk kvadalasaaghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlashhpadftpa vhasldkflasvstvltskyr
Timeline for d3hrwc_: