SCOPe 2.04: Domain d3hd8b_: 3hd8 B:

Lineage for d3hd8b_ (3hd8 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (18 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)

8. Domain d3hd8b_: 3hd8 B: [191737]
   Other proteins in same PDB: d3hd8a_, d3hd8c_
   automated match to d1xnba_

Details for d3hd8b_

PDB Entry: 3hd8, 2.39 Å

PDB Description: Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase

PDB Compounds: (B:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d3hd8b_:

Sequence; same for both SEQRES and ATOM records:

>d3hd8b_ b.29.1.11 (B:) Xylanase II {Bacillus circulans [TaxId: 1397]}
stdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwapn
gngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidgd
rttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgssn
vtvw

Timeline for d3hd8b_:

• d3hd8b_ first appeared in SCOPe 2.02
  
• d3hd8b_ appears in SCOPe 2.03
  
• d3hd8b_ appears in SCOPe 2.05
  
• d3hd8b_ appears in the current release, SCOPe 2.08