Lineage for d3h2pb_ (3h2p B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031006Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2031007Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 protein domains)
  6. 2031020Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2031123Species Human (Homo sapiens) [TaxId:9606] [49333] (79 PDB entries)
  8. 2031159Domain d3h2pb_: 3h2p B: [191736]
    automated match to d3h2pa_
    complexed with ace, mli, zn

Details for d3h2pb_

PDB Entry: 3h2p (more details), 1.55 Å

PDB Description: Human SOD1 D124V Variant
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3h2pb_:

Sequence, based on SEQRES records: (download)

>d3h2pb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekavdlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records): (download)

>d3h2pb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvhekavnagsrl
acgvigiaq

SCOPe Domain Coordinates for d3h2pb_:

Click to download the PDB-style file with coordinates for d3h2pb_.
(The format of our PDB-style files is described here.)

Timeline for d3h2pb_: