Lineage for d3gysb_ (3gys B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1076761Protein automated matches [190359] (36 species)
    not a true protein
  7. 1076855Species Cat (Felis catus) [TaxId:9685] [188888] (4 PDB entries)
  8. 1076873Domain d3gysb_: 3gys B: [191732]
    automated match to d3d4xd_
    complexed with hem

Details for d3gysb_

PDB Entry: 3gys (more details), 2.9 Å

PDB Description: crystal structure determination of cat (felis silvestris catus) hemoglobin at 2.9 angstrom resolution
PDB Compounds: (B:) Hemoglobin subunit beta-A/B

SCOPe Domain Sequences for d3gysb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gysb_ a.1.1.2 (B:) automated matches {Cat (Felis catus) [TaxId: 9685]}
fltaeekglvnglwgkvnvdevggealgrllvvypwtqrffesfgdlssadaimsnakvk
ahgkkvlnsfsdglkniddlkgafaklselhcdklhvdpenfrllgnvlvcvlahhfghd
fnpqvqaafqkvvagvanalahkyh

SCOPe Domain Coordinates for d3gysb_:

Click to download the PDB-style file with coordinates for d3gysb_.
(The format of our PDB-style files is described here.)

Timeline for d3gysb_: