![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Cat (Felis catus) [TaxId:9685] [188888] (4 PDB entries) |
![]() | Domain d3gysb_: 3gys B: [191732] automated match to d3d4xd_ complexed with hem |
PDB Entry: 3gys (more details), 2.9 Å
SCOPe Domain Sequences for d3gysb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gysb_ a.1.1.2 (B:) automated matches {Cat (Felis catus) [TaxId: 9685]} fltaeekglvnglwgkvnvdevggealgrllvvypwtqrffesfgdlssadaimsnakvk ahgkkvlnsfsdglkniddlkgafaklselhcdklhvdpenfrllgnvlvcvlahhfghd fnpqvqaafqkvvagvanalahkyh
Timeline for d3gysb_: