![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
![]() | Protein I-kappa-B-alpha [48417] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48418] (2 PDB entries) |
![]() | Domain d1nfif_: 1nfi F: [19173] Other proteins in same PDB: d1nfia1, d1nfia2, d1nfib_, d1nfic1, d1nfic2, d1nfid_ |
PDB Entry: 1nfi (more details), 2.7 Å
SCOPe Domain Sequences for d1nfif_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfif_ d.211.1.1 (F:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} ltedgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaea llgagcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhl asihgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyq gyspyqltwgrpstriqqqlgqltlenlqmlpe
Timeline for d1nfif_: