SCOPe 2.05: Domain d3gttb_: 3gtt B:

Lineage for d3gttb_ (3gtt B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [189448] (2 PDB entries)

8. Domain d3gttb_: 3gtt B: [191728]
   automated match to d3gttd_
   complexed with zn

Details for d3gttb_

PDB Entry: 3gtt, 2.4 Å

PDB Description: Mouse SOD1

PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3gttb_:

Sequence; same for both SEQRES and ATOM records:

>d3gttb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Mouse (Mus musculus) [TaxId: 10090]}
amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
gphfnphskkhggpadeerhvgdlgnvtagkdgvanvsiedrvislsgehsiigrtmvvh
ekqddlgkggneestktgnagsrlacgvigiaq

Timeline for d3gttb_:

• d3gttb_ first appeared in SCOPe 2.02
  
• d3gttb_ appears in SCOPe 2.04
  
• d3gttb_ appears in SCOPe 2.06
  
• d3gttb_ appears in the current release, SCOPe 2.08