Lineage for d3gqpd_ (3gqp D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301593Protein automated matches [190359] (42 species)
    not a true protein
  7. 2301712Species Cat (Felis catus) [TaxId:9685] [188888] (4 PDB entries)
  8. 2301716Domain d3gqpd_: 3gqp D: [191721]
    automated match to d3d4xd_
    complexed with hem

Details for d3gqpd_

PDB Entry: 3gqp (more details), 2 Å

PDB Description: crystal structure determination of cat (felis silvestris catus) hemoglobin at 2.0 angstrom resolution
PDB Compounds: (D:) Hemoglobin subunit beta-A/B

SCOPe Domain Sequences for d3gqpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqpd_ a.1.1.2 (D:) automated matches {Cat (Felis catus) [TaxId: 9685]}
fltaeekglvnglwgkvnvdevggealgrllvvypwtqrffesfgdlssadaimsnakvk
ahgkkvlnsfsdglkniddlkgafaklselhcdklhvdpenfrllgnvlvcvlahhfghd
fnpqvqaafqkvvagvanalahkyh

SCOPe Domain Coordinates for d3gqpd_:

Click to download the PDB-style file with coordinates for d3gqpd_.
(The format of our PDB-style files is described here.)

Timeline for d3gqpd_: