Lineage for d1nfie_ (1nfi E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612402Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2612403Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2612404Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2612447Protein I-kappa-B-alpha [48417] (1 species)
  7. 2612448Species Human (Homo sapiens) [TaxId:9606] [48418] (2 PDB entries)
  8. 2612450Domain d1nfie_: 1nfi E: [19172]
    Other proteins in same PDB: d1nfia1, d1nfia2, d1nfib_, d1nfic1, d1nfic2, d1nfid_

Details for d1nfie_

PDB Entry: 1nfi (more details), 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex
PDB Compounds: (E:) I-kappa-b-alpha

SCOPe Domain Sequences for d1nfie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfie_ d.211.1.1 (E:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}
ltedgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaea
llgagcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhl
asihgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyq
gyspyqltwgrpstriqqqlgqltlenlqmlpe

SCOPe Domain Coordinates for d1nfie_:

Click to download the PDB-style file with coordinates for d1nfie_.
(The format of our PDB-style files is described here.)

Timeline for d1nfie_: