SCOPe 2.06: Domain d1iknd_: 1ikn D:

Lineage for d1iknd_ (1ikn D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein I-kappa-B-alpha [48417] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48418] (2 PDB entries)

8. Domain d1iknd_: 1ikn D: [19171]
   Other proteins in same PDB: d1ikna1, d1ikna2, d1iknc_

Details for d1iknd_

PDB Entry: 1ikn, 2.3 Å

PDB Description: ikappabalpha/nf-kappab complex

PDB Compounds: (D:) protein (I-kappa-b-alpha)

SCOPe Domain Sequences for d1iknd_:

Sequence, based on SEQRES records:

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}
dgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaeallg
agcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhlasi
hgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyqgys
pyqltwgrpstriqqqlgqltlenlqmlpesedeesydtes

Sequence, based on observed residues (ATOM records):

>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]}
dgdsflhlaiiheekaltmevirlaflnfqnnlqqtplhlavitnqpeiaeallgagcdp
elrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhlasihgylg
ivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyqgyspyqlt
wgrpstriqqqlgqltlenlqmlpesedeesydtes

Timeline for d1iknd_:

• d1iknd_ first appeared (with stable ids) in SCOP 1.55
  
• d1iknd_ appears in SCOPe 2.05
  
• d1iknd_ appears in SCOPe 2.07
  
• d1iknd_ appears in the current release, SCOPe 2.08