Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (40 species) not a true protein |
Species Cat (Felis catus) [TaxId:9685] [188888] (4 PDB entries) |
Domain d3d4xb_: 3d4x B: [191706] automated match to d3d4xd_ complexed with hem |
PDB Entry: 3d4x (more details), 2.2 Å
SCOPe Domain Sequences for d3d4xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d4xb_ a.1.1.2 (B:) automated matches {Cat (Felis catus) [TaxId: 9685]} fltaeekglvnglwgkvnvdevggealgrllvvypwtqrffesfgdlssadaimsnakvk ahgkkvlnsfsdglkniddlkgafaklselhcdklhvdpenfrllgnvlvcvlahhfghd fnpqvqaafqkvvagvanalahkyh
Timeline for d3d4xb_: