SCOPe 2.03: Domain d3aluc_: 3alu C:

Lineage for d3aluc_ (3alu C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (8 species)
   not a true protein

7. Species Cucumaria echinata [TaxId:40245] [189610] (2 PDB entries)

8. Domain d3aluc_: 3alu C: [191695]
   automated match to d3alud_
   complexed with ca, edo, raf

Details for d3aluc_

PDB Entry: 3alu, 1.65 Å

PDB Description: crystal structure of cel-iv complexed with raffinose

PDB Compounds: (C:) Lectin CEL-IV, C-type

SCOPe Domain Sequences for d3aluc_:

Sequence; same for both SEQRES and ATOM records:

>d3aluc_ d.169.1.0 (C:) automated matches {Cucumaria echinata [TaxId: 40245]}
cltscpplwtgfngkcfrlfhnhlnfdnaenacrqfglascsgdelatghlasihsaesq
afltelvktslpdlitggwapqvyigmkvgstnsdqtwtdgssvdydgwvsgepnngpns
rgaiaagdysrgfwadvysnnnfkyicqlpcvhytle

Timeline for d3aluc_:

• d3aluc_ first appeared in SCOPe 2.02
  
• d3aluc_ appears in SCOPe 2.04
  
• d3aluc_ appears in the current release, SCOPe 2.08