SCOPe 2.02: Domain d2zpqb_: 2zpq B:

Lineage for d2zpqb_ (2zpq B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (13 species)
   not a true protein

7. Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [189036] (3 PDB entries)

8. Domain d2zpqb_: 2zpq B: [191691]
   automated match to d1hj8a_
   complexed with ben, ca, so4

Details for d2zpqb_

PDB Entry: 2zpq, 1.9 Å

PDB Description: Crystal structure of anionic trypsin isoform 1 from chum salmon

PDB Compounds: (B:) anionic trypsin

SCOPe Domain Sequences for d2zpqb_:

Sequence; same for both SEQRES and ATOM records:

>d2zpqb_ b.47.1.2 (B:) automated matches {Chum salmon (Oncorhynchus keta) [TaxId: 8018]}
ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstma

Timeline for d2zpqb_:

• d2zpqb_ is new in SCOPe 2.02-stable
  
• d2zpqb_ appears in SCOPe 2.03
  
• d2zpqb_ appears in the current release, SCOPe 2.08