| Class b: All beta proteins [48724] (180 folds) |
| Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
| Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
| Protein automated matches [190044] (14 species) not a true protein |
| Species Chum salmon (Oncorhynchus keta) [TaxId:8018] [189036] (3 PDB entries) |
| Domain d2zpqb_: 2zpq B: [191691] automated match to d1hj8a_ complexed with ben, ca, so4 |
PDB Entry: 2zpq (more details), 1.9 Å
SCOPe Domain Sequences for d2zpqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zpqb_ b.47.1.2 (B:) automated matches {Chum salmon (Oncorhynchus keta) [TaxId: 8018]}
ivggyeckaysqphqvslnsgyhfcggslvnenwvvsaahcyksrvevrlgehnikvteg
seqfisssrvirhpnyssynidndimliklskpatlntyvqpvalpsscapagtmctvsg
wgntmsstadknklqclnipilsysdcnnsypgmitnamfcagyleggkdscqgdsggpv
vcngelqgvvswgygcaepgnpgvyakvcifndwltstma
Timeline for d2zpqb_: