Lineage for d1a5e__ (1a5e -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616021Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 616022Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 616023Family d.211.1.1: Ankyrin repeat [48404] (16 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 616041Protein Cell cycle inhibitor p16ink4A [48414] (2 species)
  7. 616042Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries)
  8. 616044Domain d1a5e__: 1a5e - [19169]

Details for d1a5e__

PDB Entry: 1a5e (more details)

PDB Description: solution nmr structure of tumor suppressor p16ink4a, 18 structures

SCOP Domain Sequences for d1a5e__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5e__ d.211.1.1 (-) Cell cycle inhibitor p16ink4A {Human (Homo sapiens)}
mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
lghrdvarylraaaggtrgsnharidaaegpsdipd

SCOP Domain Coordinates for d1a5e__:

Click to download the PDB-style file with coordinates for d1a5e__.
(The format of our PDB-style files is described here.)

Timeline for d1a5e__: