![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (8 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (20 PDB entries) |
![]() | Domain d2zcyd_: 2zcy D: [191689] Other proteins in same PDB: d2zcy01, d2zcy1_, d2zcya_, d2zcye_, d2zcyf1, d2zcyi_, d2zcyj_, d2zcyk_, d2zcym1, d2zcyn_, d2zcyo_, d2zcys_, d2zcyt1, d2zcyw_, d2zcyx_, d2zcyy_ automated match to d1jd2y_ complexed with srg |
PDB Entry: 2zcy (more details), 2.9 Å
SCOPe Domain Sequences for d2zcyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcyd_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea ae
Timeline for d2zcyd_:
![]() Domains from other chains: (mouse over for more information) d2zcy01, d2zcy1_, d2zcya_, d2zcyb_, d2zcyc_, d2zcye_, d2zcyf1, d2zcyg_, d2zcyh_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcyl_, d2zcym1, d2zcyn_, d2zcyo_, d2zcyp_, d2zcyq_, d2zcyr_, d2zcys_, d2zcyt1, d2zcyu_, d2zcyv_, d2zcyw_, d2zcyx_, d2zcyy_, d2zcyz_ |