SCOPe 2.08: Domain d2zcyd_: 2zcy D:

Lineage for d2zcyd_ (2zcy D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d2zcyd_: 2zcy D: [191689]
   Other proteins in same PDB: d2zcy0_, d2zcy1_, d2zcya_, d2zcyc3, d2zcye_, d2zcyf_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcym_, d2zcyn_, d2zcyo_, d2zcyq3, d2zcys_, d2zcyt_, d2zcyw_, d2zcyx_, d2zcyy_
   automated match to d1jd2y_
   complexed with srg

Details for d2zcyd_

PDB Entry: 2zcy, 2.9 Å

PDB Description: yeast 20S proteasome:syringolin A-complex

PDB Compounds: (D:) Proteasome component PUP2

SCOPe Domain Sequences for d2zcyd_:

Sequence; same for both SEQRES and ATOM records:

>d2zcyd_ d.153.1.4 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Timeline for d2zcyd_:

• d2zcyd_ first appeared in SCOPe 2.02
  
• d2zcyd_ appears in SCOPe 2.07