Lineage for d2xwab_ (2xwa B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388434Protein Factor D [50563] (1 species)
  7. 2388435Species Human (Homo sapiens) [TaxId:9606] [50564] (22 PDB entries)
  8. 2388459Domain d2xwab_: 2xwa B: [191688]
    automated match to d2xwaa_
    complexed with gol; mutant

Details for d2xwab_

PDB Entry: 2xwa (more details), 2.8 Å

PDB Description: Crystal Structure of Complement Factor D Mutant R202A
PDB Compounds: (B:) complement factor d

SCOPe Domain Sequences for d2xwab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xwab_ b.47.1.2 (B:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsavcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d2xwab_:

Click to download the PDB-style file with coordinates for d2xwab_.
(The format of our PDB-style files is described here.)

Timeline for d2xwab_: