SCOPe 2.08: Domain d2xwab_: 2xwa B:

Lineage for d2xwab_ (2xwa B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Factor D [50563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50564] (29 PDB entries)

8. Domain d2xwab_: 2xwa B: [191688]
   automated match to d2xwaa_
   complexed with gol; mutant

Details for d2xwab_

PDB Entry: 2xwa, 2.8 Å

PDB Description: Crystal Structure of Complement Factor D Mutant R202A

PDB Compounds: (B:) complement factor d

SCOPe Domain Sequences for d2xwab_:

Sequence; same for both SEQRES and ATOM records:

>d2xwab_ b.47.1.2 (B:) Factor D {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsavcgnrkkpgiytrvasyaawidsvla

Timeline for d2xwab_:

• d2xwab_ first appeared in SCOPe 2.02
  
• d2xwab_ appears in SCOPe 2.07