![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
![]() | Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
![]() | Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
![]() | Protein automated matches [190406] (19 species) not a true protein |
![]() | Species Coral (Montipora efflorescens) [TaxId:105610] [188535] (3 PDB entries) |
![]() | Domain d2p4mb_: 2p4m B: [191681] automated match to d2p4md_ complexed with iod |
PDB Entry: 2p4m (more details), 1.8 Å
SCOPe Domain Sequences for d2p4mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4mb_ d.22.1.1 (B:) automated matches {Coral (Montipora efflorescens) [TaxId: 105610]} msviatqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspq cqygsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkf sglnfppngpvmqkktqgwepsserlfarggmlignnfmalkleggghylcefkttykak kpvkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva
Timeline for d2p4mb_: