Lineage for d2p4mb_ (2p4m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940361Species Coral (Montipora efflorescens) [TaxId:105610] [188535] (3 PDB entries)
  8. 2940363Domain d2p4mb_: 2p4m B: [191681]
    automated match to d2p4md_
    complexed with iod

Details for d2p4mb_

PDB Entry: 2p4m (more details), 1.8 Å

PDB Description: high ph structure of rtms5 h146s variant
PDB Compounds: (B:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d2p4mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4mb_ d.22.1.1 (B:) automated matches {Coral (Montipora efflorescens) [TaxId: 105610]}
msviatqmtykvymsgtvnghyfevegdgkgkpyegeqtvkltvtkggplpfawdilspq
cqygsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkf
sglnfppngpvmqkktqgwepsserlfarggmlignnfmalkleggghylcefkttykak
kpvkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

SCOPe Domain Coordinates for d2p4mb_:

Click to download the PDB-style file with coordinates for d2p4mb_.
(The format of our PDB-style files is described here.)

Timeline for d2p4mb_: