Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
Domain d2p4ab_: 2p4a B: [191679] Other proteins in same PDB: d2p4aa_, d2p4ac_ automated match to d2p4ad_ protein/RNA complex; complexed with so4 |
PDB Entry: 2p4a (more details), 1.9 Å
SCOPe Domain Sequences for d2p4ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4ab_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlvesggglvqaggslrlscaasgypwtyiymgwfrqapgkeregvaamdsggggtly adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggdalvatrygrwgqgtqvtvs s
Timeline for d2p4ab_: