Lineage for d2nzdh_ (2nzd H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698177Protein Histone H2B [47119] (6 species)
  7. 2698178Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (42 PDB entries)
  8. 2698208Domain d2nzdh_: 2nzd H: [191678]
    Other proteins in same PDB: d2nzda_, d2nzdb_, d2nzdc_, d2nzde_, d2nzdf_, d2nzdg_
    automated match to d1kx5d_
    protein/DNA complex; complexed with mn

Details for d2nzdh_

PDB Entry: 2nzd (more details), 2.65 Å

PDB Description: Nucleosome core particle containing 145 bp of DNA
PDB Compounds: (H:) histone h2b

SCOPe Domain Sequences for d2nzdh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nzdh_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d2nzdh_:

Click to download the PDB-style file with coordinates for d2nzdh_.
(The format of our PDB-style files is described here.)

Timeline for d2nzdh_: