| Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
| Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (1 family) ![]() repeats organized in elongated structures |
| Family d.211.1.1: Ankyrin repeat [48404] (12 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
| Protein Cell cycle inhibitor p16ink4A [48414] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries) |
| Domain d2a5e__: 2a5e - [19167] |
PDB Entry: 2a5e (more details)
SCOP Domain Sequences for d2a5e__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a5e__ d.211.1.1 (-) Cell cycle inhibitor p16ink4A {Human (Homo sapiens)}
mepaagssmepsadwlataaargrveevralleagalpnapnsygrrpiqvmmmgsarva
ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaee
lghrdvarylraaaggtrgsnharidaaegpsdipd
Timeline for d2a5e__: