Lineage for d1bi7b_ (1bi7 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685730Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1685731Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1685732Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1685754Protein Cell cycle inhibitor p16ink4A [48414] (2 species)
  7. 1685755Species Human (Homo sapiens) [TaxId:9606] [48415] (4 PDB entries)
  8. 1685756Domain d1bi7b_: 1bi7 B: [19166]
    Other proteins in same PDB: d1bi7a_

Details for d1bi7b_

PDB Entry: 1bi7 (more details), 3.4 Å

PDB Description: mechanism of g1 cyclin dependent kinase inhibition from the structure of the cdk6-p16ink4a tumor suppressor complex
PDB Compounds: (B:) multiple tumor suppressor

SCOPe Domain Sequences for d1bi7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]}
epsadwlataaargrveevralleaganpnapnsygrrpiqvmmmgsarvaellllhgae
pncadpatltrpvhdaaregfldtlvvlhragarldvrdawgrlpvdlaeelghrdvary
lraaa

SCOPe Domain Coordinates for d1bi7b_:

Click to download the PDB-style file with coordinates for d1bi7b_.
(The format of our PDB-style files is described here.)

Timeline for d1bi7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bi7a_