SCOP 1.59: Domain d1g3nf_: 1g3n F:

Lineage for d1g3nf_ (1g3n F:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)

4. Superfamily a.118.2: Ankyrin repeat [48403] (1 family)

5. Family a.118.2.1: Ankyrin repeat [48404] (10 proteins)

6. Protein p18ink4C(ink6) [48412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48413] (3 PDB entries)

8. Domain d1g3nf_: 1g3n F: [19164]
   Other proteins in same PDB: d1g3na_, d1g3nc1, d1g3nc2, d1g3ne_, d1g3ng1, d1g3ng2

Details for d1g3nf_

PDB Entry: 1g3n, 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

SCOP Domain Sequences for d1g3nf_:

Sequence; same for both SEQRES and ATOM records:

>d1g3nf_ a.118.2.1 (F:) p18ink4C(ink6) {Human (Homo sapiens)}
gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
tasnvghrnhkgdtacdlarlygrnevvslmqang

Timeline for d1g3nf_:

• d1g3nf_ first appeared (with stable ids) in SCOP 1.55
  
• d1g3nf_ appears in SCOP 1.57
  
• d1g3nf_ appears in SCOP 1.61
  
• d1g3nf_ appears in the current release, SCOPe 2.08