Lineage for d1g3nf_ (1g3n F:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50602Superfamily a.118.2: Ankyrin repeat [48403] (1 family) (S)
  5. 50603Family a.118.2.1: Ankyrin repeat [48404] (9 proteins)
  6. 50634Protein p18ink4C(ink6) [48412] (1 species)
  7. 50635Species Human (Homo sapiens) [TaxId:9606] [48413] (3 PDB entries)
  8. 50639Domain d1g3nf_: 1g3n F: [19164]
    Other proteins in same PDB: d1g3na_, d1g3nc1, d1g3nc2, d1g3ne_, d1g3ng1, d1g3ng2

Details for d1g3nf_

PDB Entry: 1g3n (more details), 2.9 Å

PDB Description: structure of a p18(ink4c)-cdk6-k-cyclin ternary complex

SCOP Domain Sequences for d1g3nf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3nf_ a.118.2.1 (F:) p18ink4C(ink6) {Human (Homo sapiens)}
gnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgnpeiarrlllrganpdl
kdrtgfavihdaaragfldtlqtllefqadvniednegnlplhlaakeghlrvveflvkh
tasnvghrnhkgdtacdlarlygrnevvslmqang

SCOP Domain Coordinates for d1g3nf_:

Click to download the PDB-style file with coordinates for d1g3nf_.
(The format of our PDB-style files is described here.)

Timeline for d1g3nf_: